PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013618837.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 318aa    MW: 36620.7 Da    PI: 5.0724
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013618837.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-182875148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l++++  +G g+W++ +r+ g++Rt+k+c++rw++yl
   XP_013618837.1 28 RGPWTVEEDFKLINYISTHGEGRWNSLSRCAGLKRTGKSCRLRWLNYL 75
                     89********************************************97 PP

2Myb_DNA-binding50.54.7e-1681124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   XP_013618837.1  81 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 124
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6722375IPR017930Myb domain
SuperFamilySSF466894.49E-3125122IPR009057Homeodomain-like
SMARTSM007172.0E-152777IPR001005SANT/Myb domain
PfamPF002493.6E-162875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-222982IPR009057Homeodomain-like
CDDcd001672.25E-113075No hitNo description
PROSITE profilePS5129422.91776130IPR017930Myb domain
SMARTSM007172.9E-1480128IPR001005SANT/Myb domain
PfamPF002497.8E-1581124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2283129IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MDDKRSLMMN KNIGDFENNV DEEMDLRRGP WTVEEDFKLI NYISTHGEGR WNSLSRCAGL  60
KRTGKSCRLR WLNYLRPDVR RGNITLEEQL LILELHSRWG NRWSKIAQYL PGRTDNEIKN  120
YWRTRVQKHA KQLKCDVNSQ QFKDTMRYLW MPRLVERIQA SASTSTGSAT TSSCVTTPSD  180
QFLMTSYDAG LNSNNNTNMD HLSFMSNPNG YVTQETSSVS VSPTSGLTEY HIGSEVEKVE  240
NNQDQSLVGP QIMSPPENYL DVNCGLLSED LTQSYHNWFE NDNGMIPPYS DSVWNIGSDE  300
DFWLLLQQQQ QLVNNGSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-262512224120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756560.0KM975656.1 Brassica napus MYB transcription factor 78-1.1 (MYB78-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013618837.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE11e-114MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D3AX420.0A0A0D3AX42_BRAOL; Uncharacterized protein
STRINGBra020624.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-132myb domain protein 78